PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000184044
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 965aa    MW: 106624 Da    PI: 7.5043
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000184044genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.83e-30269326259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES-.-SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYege.Hnhe 59 
                    +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers  d++++ei+Y+g  Hnh 
  MDP0000184044 269 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSY-DGQITEIIYKGApHNHA 326
                    7****************************************.**********9669997 PP

2WRKY104.94.3e-33507565159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+CtsagC v+k+ver+++d k+v++tYeg+Hnhe
  MDP0000184044 507 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCLVRKHVERASHDLKFVITTYEGKHNHE 565
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.3E-26263328IPR003657WRKY domain
PROSITE profilePS5081123.583263328IPR003657WRKY domain
SuperFamilySSF1182903.66E-23266328IPR003657WRKY domain
SMARTSM007742.6E-32268327IPR003657WRKY domain
PfamPF031062.0E-22269325IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.6E-36492567IPR003657WRKY domain
SuperFamilySSF1182902.88E-28500567IPR003657WRKY domain
PROSITE profilePS5081138.251502567IPR003657WRKY domain
SMARTSM007742.6E-38507566IPR003657WRKY domain
PfamPF031064.8E-25508565IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 965 aa     Download sequence    Send to blast
MEQEDDAVAE SKAKGRGGGG GGGAGSSISI AERRAAKCGF NAERINTARF RTTSPLHSPP  60
ARSPCLTIPA GISPTALLDS PMMLPQFSSS ISASGCKQFG SREKALPSPT TGTFPLHPPN  120
DNSSLLKSGT HEDDGYRPAY SSFQNPFFAR LCLNEFGIFP LHFPQGSTVD CQALVLEQPP  180
MEFQFPMEFP EEANATNYAV DLSSXIRNLN SVIMIANGAD LQMSHSSAAS DQNFLPKESI  240
HVEDLGSHHF LEGDQKGSYP SAGMVRTSED GYNWRKYGQK QVKGSEYPRS YYKCTHPNCQ  300
VKKKVERSYD GQITEIIYKG APHNHAKPQP NRRTGASLGP SFSYDEMSEM GEGSRAAVKG  360
EGGPVWTNSQ SCKDMKVGYD GRTDGLERTS SASVVTELSD PFSTTQGKSM NIFESAETPE  420
LSSTLASHDD EDRATQGIIS LGDDADDEES DSKRRQVIFC LSRRFLFPGC HDRTRKKESC  480
MIETNLASRA VREPRVVVQI ESEIDILDDG YRWRKYGQKV VKGNPNPRSY YKCTSAGCLV  540
RKHVERASHD LKFVITTYEG KHNHEVPAAR NSNHMNSISS NGLPSTANAQ PALALPRNTN  600
VPKPETQVQD LAPHFDRKPE FHDAYMRPNF LGNFNNDMKF GASSLYQMKY PPLHNTMPYA  660
SFGHNVAHQA GSIVPDFPIS LPMNLQPSGN LPLAGYDINN GKTVCPVQPY FSGQHLQEND  720
VRFLKPKQEX KDDNLYDARL PIMDQSSASL SSSSSLFYHR ILCIPTQQHS DFRHRNQGDF  780
RVPMPETKRF VNTDDRMRLK LEKGASTDAG AWLVSVLDRL RLGAGAGVAV YNFLLLERDL  840
RMTSLVVNLD RLYVWRRDLA VRALHLRVSS LLLSGPVSYT SLPAAAVRRG SIDLGGDLLG  900
RVLLGLGFAC HVGRFDRTAE MKTLTLTVGH SDGEXLKLLR MEDGVYGPLY IGFICLVYSD  960
VRELG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-34257568178Probable WRKY transcription factor 4
2lex_A8e-34257568178Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.31871e-157bud| cell culture| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1129100.0JX112910.1 Malus hupehensis C2H2-type zinc finger protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008389044.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLM5WG220.0M5WG22_PRUPE; Uncharacterized protein (Fragment)
STRINGGLYMA18G47741.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83493445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.25e-84WRKY family protein